Boolean Biotech VHH Design Competition 2025

This is quite a departure for this blog, but I thought it might be fun to follow Adaptyv Bio, Specifica, Ginkgo, et al. and run my own (tiny) protein design competition, the "Boolean Biotech VHH Design Competition 2025"!

Why do this when there are other, larger competitions? The twist is that instead of submitting a design tuned to the target, you submit a script that outputs designs for any target. The goal is to see how good we are at making VHHs with open models, limited compute, and no manual supervision. I am optimistic I'll get at least one submission!

The rules

  • For simplicity, entrants should use the standard hNbBCII10 VHH.
>hNbBCII10
QVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAVRGYFMRLPSSHNFRYWGQGTLVTVSS
>hNbBCII10_with_CDRs_Xd
QVQLVESGGGLVQPGGSLRLSCAASXXXXXXXXXXXLGWFRQAPGQGLEAVAAXXXXXXXXYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCXXXXXXXXXXXXXXXXXXWGQGTLVTVSS
  • The target is Maltose-binding protein from BenchBB (PDB code: 1PEB). BenchBB, an Adaptyv Bio project, has seven targets to choose from. The alternatives are either too large (Cas9), arguably too small (BHRF1, BBF-14) or already well-trodden (EGFR, PD-L1 and IL-7Rα).
  • You submit one Python script that I can run using the uvx modal run command below (optionally using --with PyYAML or other libraries.) The script should use ideally use all the chains in the PDB file as the target. For simplicity, if your design tool uses only sequence and not structure, extract the sequence from the PDB file.
uvx modal==1.2.0 run {your_pipeline_name}.py --input-pdb {pdb_name}.pdb
  • I will use $50 of compute on any GPU available on modal to produce a binder. The modal script should output a file called {your_pipeline_name}.faa with a maximum of 10 designs that looks like this:
>{optional_info_1}
{binder_seq_1}
>{optional_info_2}
{binder_seq_2}
...
  • I can run non-open pipelines (e.g., pipelines that use PyRosetta), but the intention of the competition is to compare open pipelines, e.g., FreeBindCraft over BindCraft.
  • To rank designs, I will fold with AF2-Multimer with 3 recycles and MSA, and take the designs with the maximum ipTM. Of course, your script is free to do its own ranking and output a single result.
  • I will submit the 10 best submissions to BenchBB, with a max of one per entrant (though if there are fewer than 10 entries, I'll run more than one per entrant.) I'll test more if i can! Ideally I would like to test multiple targets with the same pipeline.
  • You have until Friday November 7th to submit. This is not that much time but the hope is that submissions should mostly run existing open pipelines, adapted to run as a single modal script, so there should not be a lot of target-specific tuning going on.
  • Since I have no idea if I'll get any submissions within this timeframe, and it's a pretty casual competition, I reserve the right to change the rules above a bit. I think there is a good chance I'll end up just submitting some designs myself, but it's fun to let other people try if they like!

The competition

Obviously, this will be a small competition, so I won't be too strict if there are issues, but I don't want to spend time on environments, jax, cuda, etc. This is a very appealing aspect of forcing the competition to run on uv and modal: one portable script should be able to do whatever you need.

All the code, designs and stats will be made public, and will appear on ProteinBase (Adaptyv Bio's public database), hopefully a few weeks after the competition ends. Adaptyv Bio has its own BenchBB stuff in the works too.

The prize is even better than lucre: it's glory, and maybe a t-shirt? A plausibly easy way to enter would be to use the IgGM modal app from the biomodals repo, which should be almost plug-and-play here.

This competition is difficult, maybe way too difficult! Even the best models today recommend testing 10s of designs for every target. So it might be impossible, but I am struck that one submission from the BindCraft team to the 2024 Adaptyv competition bound, and at 100nM too!

If the expected outcome of everything failing comes to pass, maybe I will try again when the technology has progressed a bit.

(Thanks to Nick Boyd for help with figuring out the rules.)


AI antibody design in 2025

This is a continuation of my past articles on protein binder design. Here I'll cover the state-of-the-art in AI antibody design.

Antibodies and antibody fragments (e.g., Fab, scFv, VHH) are particularly important in biotech, because they are highly specific, adaptable to almost any target, and have a proven track record as therapeutics. Full antibodies also have Fc regions, so they can activate the immune system as well as bind. In this article I'll just use the term "antibody" but many of the design approaches discussed below generate these smaller antibody fragments.

A menagerie of antibody fragments (Engineered antibody fragments and the rise of single domains, Nature Biotech, 2005)

Last year we saw a lot of progress in mini-binder design (especially BindCraft), but this year there has been a lot of activity in antibody and peptide design too, as it becomes clear that there are commercially important opportunities here. BindCraft 2 will likely include the ability to create antibody fragments; a fork called FoldCraft already enables this.

Antibodies are proteins, so why is antibody design not just the same problem as mini-binder design? In most ways they are the same. The main difference is that the CDR loops that drive antibody binding are highly variable and do not benefit directly from evolutionary information the way other binding motifs do. Folding long CDR loops correctly is especially difficult.

Here I'll review the latest antibody design tools. I'll also provide some biomodals code to run in case the reader wants to actually design their own antibodies!

RFantibody

While there were other antibody design tools before it, especially antibody language models, RFantibody was arguably the first successful de novo antibody design model. It is a fine-tuned variant of RFdiffusion, and like RFdiffusion it requires testing thousands of designs to have a good shot at producing a binder. The original RFantibody paper was originally published way back in March 2024, so as you'd expect, the performance—while remarkable for the time—has been surpassed, and Baker lab seems to have moved on to the next challenge. (Note, the preprint was first published in 2024 but the code was only released this year.)

The diffusion process as illustrated in the RFantibody paper

IgGM

It's pretty interesting how many Chinese protein models there are now. Many of these models are from random internet companies just flexing their AI muscles. IgGM is a brand new, comprehensive antibody design suite from Tencent (the giant internet conglomerate). It can do de novo design, affinity maturation, and more.

There are some troubling aspects to the IgGM paper. Diego del Alamo notes that the plots have unrealistically low variance (see the suspicious-looking plot below). When I run the code, I see what look like not-fully-folded structures. However, there is also strong empirical evidence it's a good model: a third place finish in the AIntibody competition (more information on that below).

Suspiciously tight distributions in plots from the IgGM paper. Sometimes this is due to plotting standard error vs standard deviation.

To run IgGM and generate a nanobody for PD-L1, run the following code:

# get the PD-L1 model from the Chai-2 technical report, only the A chain
curl -s https://files.rcsb.org/download/5O45.pdb | grep "^ATOM.\{17\}A" > 5O45_chainA.pdb
# get a nanobody sequence from 3EAK; replace CDR3 with Xs; tack on the sequence of 5O45 chain A
echo ">H\nQVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCXXXXXXXXXWGQGTLVTVSSRGRHHHHHH\n>A\nNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHHHH" > binder_X.fasta
# run IgGM; use the same hotspot from the Chai-2 technical report (add --relax for pyrosetta relaxation)
uvx modal run modal_iggm.py --input-fasta binder_X.fasta --antigen 5O45_chainA.pdb --epitope 56,115,123 --task design --run-name 5O45_r1

IgGM has one closed library dependency, PyRosetta, but this is only used for relaxing the final design, so it is optional. There are other ways to relax the structure, like using pr_alternative_utils.py from FreeBindCraft (a fork of BindCraft that does not depend on PyRosetta) or openmm via biomodals as shown below. FreeBindCraft's relax step has extra safeguards that likely make it work better than the code below.

uvx modal run modal_md_protein_ligand.py --pdb-id out/iggm/5O45_r1/input_0.pdb --num-steps 50000

PXDesign

Speaking of Chinese models, there is also a new mini-binder design tool called PXDesign from ByteDance, which is available for commercial use, but only via a server. It came out of beta just this week. The claimed performance is excellent, comparable to Chai-2. (The related Protenix protein structure model, "a trainable, open-source PyTorch reproduction of AlphaFold 3", is fully open.)

PXDesign claims impressive performance, comparable to Chai-2

Germinal

The Arc Institute has been on a tear for the past year or so, publishing all kinds of deep learning models, including the Evo 2 DNA language model and State virtual cell model.

Germinal is the latest model from the labs of Brian Hie and Xiaojing Gao, and this time they are joining in on the binder design fun. Installing this one was not easy, but eventually Claude and I got the right combination of jax, colabdesign, spackle and tape to make it run.

Unfortunately, there are also a couple of closed libraries required: IgLM, the antibody language model, and PyRosetta, which both require a license. AlphaFold 3 weights, which are thankfully optional, require you to petition DeepMind, but don't even try if you are a filthy commercial entity!

At some point all these tools need to follow Boltz and become fully open, or it will keep creating unnecessary friction and slowing everything down.

The code below uses Germinal to attempt one design for PD-L1. It should take around 5 minutes and cost <$1 to run (using a H100). Note, I have not gotten Germinal to ever pass all its filters, which may be a bug, but it does still output designs with reasonable metrics. The code was only released this week and is still in flux, so I don't recommend any serious use of Germinal until it settles down a bit. My code below just barely works.

# Get the PD-L1 pdb from the Chai technical report
curl -O https://files.rcsb.org/download/5O45.pdb
# Make a yaml for Germinal
echo 'target_name: "5O45"\ntarget_pdb_path: "5O45.pdb"\ntarget_chain: "A"\nbinder_chain: "C"\ntarget_hotspots: "56,115,123"\ndimer: false\nlength: 129' > target_example.yaml
# Run Germinal; this is lightly tested, no guarantees of sensible output!
uvx --with PyYAML modal run modal_germinal.py --target-yaml target_example.yaml --max-trajectories 1 --max-passing-designs 1

Mosaic

Mosaic is a general protein design framework that is less plug-and-play than the others listed above, but enables the design of mini-binders, antibodies, or really any protein. It's essentially an interface to sequence optimization on top of three structure prediction models (AF2, Boltz, and Protenix.) You can construct an arbitrary loss function based on structural and sequence metrics, and let it optimize a sequence to that loss.

While mosaic is not specifically for antibodies, it can be configured to design only parts of proteins (e.g., CDRs), and it can easily incorporate antibody language models in its loss (AbLang is built in). The main author, Nick Boyd from Escalante Bio, wrote up a recent blog post on mosaic, and showed results comparable to the current state-of-the-art models like BindCraft. Unlike some other tools listed here, it is completely open.

Mosaic has performance comparable to BindCraft on a small benchmark set (8/10 designs bound PD-L1 and 7/10 bound IL7Ra)

Commercial efforts

Chai-2

Chai-2 was unveiled in June 2025, and the technical report included some very impressive results. They claim a "100-fold" improvement over previous methods (I think this is a reference to RFantibody, which advised testing thousands of designs, versus tens for Chai-2.)

Chai-2 successfully created binding antibodies for 50% of targets tested, and some of these were even sub-nanomolar (i.e., potencies comparable to approved antibodies). It is a bit dangerous to compare across approaches without a standardized benchmark—for example, some proteins like PD-L1 are easier to make binders for—but I think it's fair to say Chai-2 probably has the best overall performance stats of any model to date, mini-binder or antibody. One criticism I have heard of these results is that the Chai team measured binding at 5-10uM in BLI, which is not recommended as it can include weak binders.

Nabla Bio

Like Chai, Nabla Bio appear to be focused on model licensing and partnering with pharma, as opposed to their own drug programs. This year they published a technical report on their JAM platform where they demonstrated the ability to generate low-nanomolar binders against GPCRs, a difficult but therapeutically important class of targets. This may be one of very few examples where an AI approach has shown better performance than traditional methods, rather than just faster results.

Nabla Bio showing impressive performance against two GPCRs

Diffuse Bio

Diffuse Bio's DSG2-mini model was also published in June 2025. There is not too much information on performance apart from a claim that it "outperforms RFantibody on key metrics". Like Chai-2, the Diffuse model is closed, though their sandbox is accessible so it's probably a bit easier to take for a test drive than Chai-2.

Screenshot from the Diffuse Bio sandbox

Tamarind, Ariax, Neurosnap, Rowan

Every year there are more online services that make running these tools easier for biologists.

Tamarind does not develop its own models, but allows anyone to easily run most of the open models. Tamarind have been impressively fast at getting models onboarded and available for use. They have a free tier, but realistically you need a subscription to do any real work, and I believe that costs tens of thousands per year. Neurosnap looks like it has similar capabilities to Tamarind, but the pricing may be more suitable for academics or more casual users. Ariax has done an incredible job making BindCraft (and FreeBindCraft) available and super easy to run. They don't generate antibodies yet, but they will once a suitably open model is released. Rowan is more small molecule- and MD-focused than antibody-focused—they even release their own MD models—so although a fantastic toolkit, less relevant to antibody design.

Tamarind has over one hundred models, including all the major structure prediction and design models

Xaira, Generate, Cradle, Profluent, Isomorphic, BigHat, etc

There are a gaggle of other actual drug companies working on computational antibody design, but these models will likely stay internal to those companies. Cradle is the outlier in this list since it is a service business, but I believe they do partnerships with pharma/biotech, rather than licensing their models.

It will be interesting to see which of these companies figure out a unique approach to drug discovery, and which get overtaken by open source. Most people in biotech will tell you that if you want a highly optimized antibody and can wait a few months, companies like Adimab, Alloy, or Specifica can already reliably achieve that, and the price will be a small fraction of the total cost of the program anyway.

Benchmarks

AIntibody

The AIntibody competition, run by the antibody discovery company Specifica, is similar to last year's Adaptyv binder design competition, but focused on antibodies.

The competition includes three challenges, but unlike the Adaptyv competition, none of the challenges is a simple "design a novel antibody for this target". The techniques used in this competition ended up being quite complex workflows specific to the challenges: for example, a protein language model combined with a model fine-tuned on affinity data provided by Specifica.

Interestingly, the "AI Biotech" listed as coming third is—according to their github—IgGM. The Specifica team has given a webinar on the results with some interesting conclusions, but the full write-up is still to come.

Conclusions from the AIntibody webinar

Ginkgo

Just this week, Ginkgo Datapoints launched a kaggle-style competition on huggingface with a public leaderboard. This challenge is to predict developability properties (expression, stability, aggregation), which is a vital step downstream of making a binder. The competition deadline is November 1st.

BenchBB

BenchBB is Adaptyv Bio's new binder design benchmark. While it's not specifically for antibodies, if you did try to generate PD-L1 binders using the biomodals commands given above, you could test your designs here for $99 each.

We know we need a lot more affinity data to improve our antibody models, and $99 is a phenomenal deal, so some crypto science thing should fund this instead of the nonsense they normally fund!

There are seven currently available BenchBB targets

Conclusion

I often seem to end these posts by saying things are getting pretty exciting. I think that's true, especially over the past few weeks with IgGM and Germinal being released, but there are also some gaps. RFantibody was published quite a while ago, and we still only have a few successors, most of which are not fully open. The models are improving, but large companies like Google (Isomorphic) are no longer releasing models, so progress has slowed somewhat. Mirroring the LLM world, it's left to academic labs like Martin Pacesa, Sergey Ovchinnikov, Bruno Correia and Brian Hie, and Chinese companies like Tencent to push the open models forward.

I did not talk about antibody language models here even though there are a lot of interesting ones. It would be a big topic, and they are more applicable to downstream tasks, once you have a binder to improve upon.

As with protein folding (see SimpleFold from this week!), there is not a ton of magic here, and many of the methods are converging on the same performance, governed by the available data. To improve upon that, we/someone probably needs to spend a few million dollars generating consistent binding and affinity data. In my opinion, Adaptyv Bio's BenchBB is a good place to focus efforts.

Publicly available affinity data from the AbRank paper. Most of the data is from SARS-CoV-2 or HIV, so it's not nearly as much as it seems.

Running the code

If you want to run the biomodals code above and design some antibodies for PD-L1 (or any target) you'll need to do a couple of things.

 1. Sign up for modal. They give you $30 a month on the free tier, more than enough to generate a few binders.

 2. Install uv. If you use Python you should do this anyway!

 3. Clone my biomodals repo:

git clone https://github.com/hgbrian/biomodals # or gh repo clone hgbrian/biomodals

AI and protein patents

The new class of protein AI design tools are amazing, and could revolutionize many areas of science, including therapeutics, diagnostics, and biosensors. Surprisingly, one important area that I haven't seen discussed too much is how these tools could impact patents. I am not a lawyer, so obviously this post is just my basic understanding, and I'd be happy to hear corrections. If there is a more expert critique I did not find it.

Patents are wordy and convoluted by design. For proteins, because a string of amino acids defines them, there are some common elements: they often include the sequence(s) being patented, and a threshold for how similar another sequence can be before infringing. That means there is a target to hit, and AI is really good at hitting targets.

There are two major categories of protein patents: biologics (usually meaning antibodies) and enzymes.

Antibodies

According to the European Patent Office, there are two main ways to patent an antibody:

  • "functional" claims, usually meaning the antibody's associated antigen or epitope;
  • "structural" claims, usually meaning a sequence and sequence identity threshold, along with the epitope or some other support.

Over the past few years, the "functional" claim has been going away. In the US it was killed off by the 2023 Amgen vs Sanofi ruling, which essentially said you can't patent the concept of an antibody against PCSK9. That means antibodies are now almost exclusively patented based on their structure (more specifically, a sequence plus some supporting functional information like epitope affinity.)

For antibody sequences, it used to be common for claims to cover any sequence 80%+ identical in the heavy or light chains. These days it seems like you have to be more specific, with claims only covering 100% identity to all 6 CDRs.

To take some real examples:

  • Zanidatamab, a HER2 bispecific approved in 2024, claims sequences with 100% sequence identity to its CDRs;
  • Epcoritamab, a CD3/CD20 bispecific approved in 2024, also has claims sequences with 100% sequence identity to its CDRs;
  • Trastuzumab, the famous HER2 antibody approved in 1998 (filed in 2013), claims sequences with 85%+ sequence identity to the heavy and light chains, and does not mention CDRs at all.

The EPO says: "the slightest modification of the CDRs can affect the recognition of the target." There is a nice breakdown of the differences between the USPTO vs EPO approach to antibody patents here.

Enzymes

For enzymes, the patent landscape is more complicated, or at least more varied. Unlike antibodies, where the patents are pretty uniformly focused on the sequence that binds an epitope, enzymes can perform any number of functions. Enzyme types include enzyme replacement therapies, industrial enzymes like detergents, and molecular biology tools like CRISPR-Cas9. It is still typical for these patents to include a sequence and supporting information.

Some examples:

  • this detergent patent, granted in 2018, claims sequences with 60%+ sequence identity to the reference;
  • this proteinase patent, granted in 2022, claims sequences with 90%+ sequence identity to the reference;
  • this novel Taq polymerase patent, granted in 2025, claims sequences with 95%+ sequence identity to the reference.

Cas9

The Cas9 patents are unusually diverse: there are hundreds of them and they mostly cover the many applications of the invention rather than the sequences. Since the 2013 ruling against Myriad Genetics, sequences from naturally occurring enzymes like Cas9 cannot be patented. Engineered sequences can be patented with other supporting functional information. You cannot take one of the thousands of unique Cas9 sequences in GenBank and use that to circumvent the CRISPR-Cas9 patents.

There are hundreds of Cas9 patents covering everything anyone could think of

AI

Given that the amino acid sequence is so important in protein patents, I am surprised that it is not bigger news that AI has effectively broken the direct connection between sequence and function.

For patents where protein sequence identity is protected, it is now relatively straightforward to generate new sequences that fold to the same structure but have 50% or lower sequence identity.

For antibody patents where the CDR sequence is protected, I believe it is also relatively straightforward to introduce a mutation that does not disrupt binding. To be honest, I am not even sure AI is required here, since a mutation scan could perform the same function. Perhaps for this reason, a recent paper called for "comprehensive CDR scanning" to protect a panel of CDR sequences instead of just one.

ProteinMPNN, published in 2022 by Baker lab, is the most prominent tool for producing a new sequence that folds to a known structure. ProteinMPNN is widely used as a step in many protein design workflows. For example, methods like RFdiffusion generate backbone coordinates only, and ProteinMPNN turns that into an amino acid sequence.

In a follow-up ProteinMPNN paper, the authors demonstrated that they could make a myoglobin and TEV protease with comparable or better function and greater stability than the natural versions, with sequence identities as low as 40%. This is below the sequence identity threshold in any patent I have seen.

ProteinMPNN can be used to produce a new sequence for a protein while maintaining its function

Sequence vs Structure

If this ability for AI to circumvent sequence-based patents is an issue, maybe the obvious change here would be to base patent protection on structure. This is a bit more complex than sequence identity, but one way to do this would be with TM-align or a similar tool. TM-align has >3k citations so it is arguably the standard in the field. A TM-score of above 0.8 indicates "the same topology"—in other words a very close structure. I think this would work well for many proteins, though it might need to be constrained to subdomains (akin to CDRs) in some cases.

Interestingly, the only literature I found on patenting 3D structure is from 20 years ago. Maybe this has been debated already and rejected for some reason. I suspect it was just easier to use sequence though.

OpenCRISPR-1

OpenCRISPR-1 was published in 2024 by the protein AI company Profluent. This is a de novo Cas9 enzyme that is substantially different in sequence to any known Cas9 (according to the abstract, "400 mutations away in sequence [from SpCas9]"—specifically 403/1380, or 71% identity).

Cas9 is a bilobed enzyme, with a REC lobe (nucleotide recognition) and a NUC lobe (DNA cleavage and PAM recognition.) Broadly speaking, the REC lobe is the first half of the enzyme (amino acids 50–700), and the NUC lobe is the second (1–50 and 700–1350.) These two lobes are connected by a "bridge helix".

Cartoon representation of Cas9 from addgene.

The OpenCRISPR-1 enzyme is not as novel as it might seem. In fact, I found it is actually 98% identical to a sequence constructed from three Cas9's spliced together from Streptococcus cristatus, Streptococcus pyogenes and Streptococcus sanguinis (24 amino acids are unique to OpenCRISPR-1).

This raises an interesting question, which is whether you could create a "novel" Cas9 by simply stitching together the REC lobe from one species' Cas9 and the NUC lobe from another. I believe this enzyme would work, and this sequence would meet any sequence identity threshold requirements.

The Profluent paper says the OpenCRISPR-1 enzyme was released for "research and commercial applications", but there is a big caveat here. Since CRISPR-Cas9 patents post-date the Myriad decision, almost all are functional / method of use, and naturally the most protected part is the use of Cas9 in "commercial applications" like therapeutics and diagnostics.

It is commendable that Profluent tried to broaden the availability of Cas9, so I appreciate the work behind this, but as I understand it, OpenCRISPR-1 is not really more available for commercial use than any Cas9.

There is actually another "royalty-free" Cas, a "Class 2 Type V" Cas nuclease called MAD7, released by Inscripta for commercial use in 2023. I do not know how this enzyme intersects with the many Cas9 patents.

Conclusion

One upshot of all this AI work is that me-too and biosimilar antibodies will be easier to make. That saves some time and money, but does not necessarily save on the major clinical trial costs, although the probability of success could go up a lot if the antibody is functionally identical.

While many enzyme patents will be affected, patents like CRISPR-Cas9 that rely on functional or method of use claims do not seem to be impacted as much. I don't know how many enzyme patents rely on sequence identity claims vs other claims these days. It would be interesting to (get an AI to) do a proper survey.

For internal research use, it's unclear to me that using AI to reproduce a patented protein does a whole lot, since at least in drug development, the research exemption seems to allow for the use of patented material quite broadly.


Protein binder design revisited

A review of protein binder design

Read More


The Adaptyv binder design competition

Some notes on the Adaptyv binder design competition

Read More


A simple way to simulate protein–ligand interactions (that does not work)

Molecular dynamics code for protein–ligand interactions

Read More


Colab and computational tools for drug design

Using colab to chain computational drug design tools

Read More


Using GPT-3 as a knowledge-base in biotech

Using GPT-3 as a knowledge-base for a biotech

Read More


Computational tools for drug development

Computational tools for drug development

Read More


Modern biotech data infrastructure

Some notes on setting up data infrastructure for a new biotech.

Read More